SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000018727 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000018727
Domain Number 1 Region: 876-1087
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-54
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 1250-1436
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-26
Family Pleckstrin-homology domain (PH domain) 0.00000889
Further Details:      
 
Domain Number 3 Region: 1076-1196
Classification Level Classification E-value
Superfamily PH domain-like 5.03e-25
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000018727
Sequence length 1440
Comment (Equus caballus)
Sequence
MAEGGERGIELHGEIMTSAAEIKKPPVAPKPKFVVANNKPAPPPVAPKPDIVISSVPQST
KKTKPTIAPKPKVLKGSPTRDIGQSPSRKIIVNLEDHKQELLENADNSNCKNIGHQSSGY
VLPMCSCSSECIHKLGNRENLCVKQLVFESLEMHENLENSKIDESPSAIKTRSKYDSNGE
KVKSQCGVILKASILEEKLKDVLTHRTSPFISPQKHRSTDSPEMNDGCNPNRQFRIEFAD
LSRSLSSFEKVPNFHFCHLQLPSDEFQNFGTCQDGSEKSNTCFHSSEQEALENGKRSTFL
SSDGVGKKSELEDLGPLEIHLVPYTPKFPIPKPRKTRAARLLRQKYIDTPSESTEEPENL
EKSASCLFEDNLKNNKIDVLHQNVLCNREQVDKVKPGNKSEVNVDSNSDGQNLVDSQRAM
CHGTSSSEKMVPPLDTDSNSSSDSKTLDGSSMSLAEDKETSFIRCNTLSMSLPKQLKLTC
NEHLPTACNPGVSAPQMPKESTIKDESSSRIAPKKPQRHSLPAAGVLKKAASEELVEKSS
YPSNEEKNSERGLERNDLGHLCAQSHGMSSSDMPKRASEKPVWKLPHPILPFSGNPESLK
SVAISSNSEPSTALTKPRAKSLSAMDAEKCTKPCKDSQKKNSLKKLLNMKLSLCFMKSDF
QKFWFKSSQLGDSGGERKGIESDWHGLLVEEKRSKPIKAYSADNYSLESQKKKKYRGQIS
AANGPRAESLDDQMLSRESSSQAPCKSVTSGCAPEYENVRHYEEIPEYENLPFIMAIGKT
PELEWQNSNSTEDTDANVYEVEEPYEAPDGQLQPGPRRQHSSSGASQEGHNDLDLGLSDL
PSDEEEVINSSDEDDVSSGSSKGEPDLLEDKQDEDIGMKSKVHHIAEEIMSSEKVFVDVL
KLLHIDFRDVVAHASRQLGKPVIEDRILNQILYYLPQLYELNRDLLKELEERMLNWTEQQ
RIADIFVKKGPYLKMYSTYIKEFDKNIALLDEQCKKNPGFAAVVREFEMSPRCANLALKH
YLLKPVQRIPQYRLLLTDYLKNLLEDSGDYRDTQDALAVVIEVANHANDTMKQGDNFQKL
MQIQYSLNGHHEIVQPGRVFLKEGTLMKLSRKVMQPRVFFLFNDALLYTTPVQSGMYKLN
NMLSLAGMKVRKPTQEAYQNELKIESVERSFILSASSATERDEWLEAISRSIEEYAKKRI
TFCASRSLDEADSENKEEVSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKI
VCQACSSNKYGLDYLKNQPARVCEHCFQELQKLDHQHSPKIGSPGNHKSPSSALSSVLHS
IPSGRKQKKIPAALKEVSANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASED
VAALESQPLLGFTVTQVKDENSESRVFQLLHKNMLFYVFKADDAHSAQKWIEAFQEGTIL
Download sequence
Identical sequences F6T955
9796.ENSECAP00000018727 ENSECAP00000018727 ENSECAP00000018727 XP_014592242.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]