SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000019132 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000019132
Domain Number 1 Region: 447-701
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.95e-73
Family Eukaryotic proteases 0.0000000104
Further Details:      
 
Domain Number 2 Region: 24-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-30
Family Spermadhesin, CUB domain 0.0001
Further Details:      
 
Domain Number 3 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-27
Family Spermadhesin, CUB domain 0.0000368
Further Details:      
 
Domain Number 4 Region: 376-455
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000124
Family Complement control module/SCR domain 0.000017
Further Details:      
 
Domain Number 5 Region: 308-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000695
Family Complement control module/SCR domain 0.0000234
Further Details:      
 
Domain Number 6 Region: 138-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000533
Family EGF-type module 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000019132
Sequence length 705
Comment (Equus caballus)
Sequence
MWLLYLLVPVLFCRVEGSIPIPQKLFGEVTSPLYPKTYPNNFETTTLITVPTGYRVKLVF
WQFDLEPSEGCFYDYVKISADKKTLGRFCGQPDSPLGNHPGKKEFVSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECASQRNSVEENPQPKCQQLCHNYIGGYFCSCRLGY
ELHKDRHSCQAECSNELYTEPSGYVSSLEYPQPYPPDLRCNYSIRVERGLTIKLKFLEPF
EIDDHQQVHCPYDQLQIYASGRNMGEFCGTQRPTDLDISGNAVDLLFFTDESGESRGWKL
HYTTEVIKCPQPKTLDEFTILQNPQAQYQFRDYYIATCKQGYQLMEGKQALLSFTAVCQD
DGTWHRAMPRCKIKNCGQPRSLTNGDFNYTTTKGVNTYQARIQYYCHEPYYKMQTRHGLS
ESERGMYTCTAQGIWKNEYGGEKIPRCLPVCGKPVNPVEQKQRIIGGQKAKLGNFPWQAY
TNIHGRGGGALLGDRWILTAAHTLRPKDYSAQNNDSVDVFLGHVSVEEITKMAHHPVRKV
IIHPDYRQEESHNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDWGLMGYVSGFGIME
DRLSHDLRFVRLPVAKREACERWLRGKRRNDVFSQNMFCAGDPSLKQDACQGDSGGVFAV
RDQNNDRWVATGIVSWGIGCSRGYGFYTNVLNYVDWIKKEMGEED
Download sequence
Identical sequences F6Z5L1
ENSECAP00000019132 XP_005610953.1.31192 XP_008537369.1.77740 9796.ENSECAP00000019132 ENSECAP00000019132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]