SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000019477 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000019477
Domain Number 1 Region: 726-1078
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.54e-54
Family Ankyrin repeat 0.0000398
Further Details:      
 
Domain Number 2 Region: 441-712
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.62e-47
Family Ankyrin repeat 0.00043
Further Details:      
 
Domain Number 3 Region: 220-408,439-520
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.37e-46
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 4 Region: 48-153
Classification Level Classification E-value
Superfamily POZ domain 1.53e-19
Family BTB/POZ domain 0.0085
Further Details:      
 
Domain Number 5 Region: 1103-1162
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.21e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000019477
Sequence length 1168
Comment (Equus caballus)
Sequence
MAEEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCSLLAAQTNKESSSESFISRLLMIVAD
LYEQEQYSDLKIKVGGRHINAHKFVLAARSDSWSLANLSSIEELDLSDANPEVTMTMLRW
IYTDELEFKEDDVFLTELMKLANRFQLQLLRERQKGVMSLVNVRNCIRFYQTAEELNAST
LMNYCAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYLIEM
DSQLPGKLNEVDHNGDLALDLALSRRLESIASTLVSHKADVDMVDKNGWSLLHKGIQRGD
LFTATFLIKSGAHVNAATLGAQETPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANPN
MQDNKGRTPLHLSITARNEYVFNQLLQCKQLDLELKDHEGSTALWLAVQYITVSSDQSVN
PFEDLPVVNGTSFDENSFAARLIQRGSNTNAADTVTGNCLLQRAAEAGNEAAALFLATNG
AHVNHRNKWGETPLHTACRHGLASLTAELLQQGANPNLQTEEAPPLPKEPASLTSSVDRV
SLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTGM
HTIAAQLLGSGACINDTMSDGQTLLHMAMQRQDSKSALFLLEHQADINVRTQDGETALQL
AIRNQLPLVVDAICTRGADMSVPDEKGNPPLWLALANNLEDIASTLVRHGCDATFWGPGP
SGCLQTLLHRAIDENNESTACFLIRSGCDLNSPRQPGANGEGEEEARDGQTPLHLAASWG
LEETVQCLLEFGANVNAQDAEGRTPVHVAISNQHSVIIQLLISHPDIHLNVRDRQGLTPF
ACAMTYKNNKAAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVQANVNSRV
QDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLEN
GVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKENA
AAIFDLFLECMPEYPLDKPDAEGNTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIF
NYQVATKQLLFRLLDMLSKEPPWCDGSNCYECTAKFGVTTRKHHCRHCGRLLCHKCSTKE
IPIIKFDLNKPVRVCNICFDVLTLGGVS
Download sequence
Identical sequences F6YAH4
ENSECAP00000019477 9796.ENSECAP00000019477 ENSECAP00000019477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]