SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000019503 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000019503
Domain Number 1 Region: 321-542
Classification Level Classification E-value
Superfamily vWA-like 7.36e-52
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 161-350
Classification Level Classification E-value
Superfamily vWA-like 1.49e-43
Family Integrin A (or I) domain 0.0012
Further Details:      
 
Domain Number 3 Region: 28-123
Classification Level Classification E-value
Superfamily LCCL domain 1.57e-27
Family LCCL domain 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000019503
Sequence length 549
Comment (Equus caballus)
Sequence
MSAAWIPVLCLGVCLLLPEPAGSEGAVPIAITCFTRGLDIRKEKADVLCPGDCPLDEFSV
FGNIVYASVSSICGAAIHRGVIGNSGGPVRIYSLPGRENYSSVVANGIQSQTLSRWSASF
TVTKGRSGTQEATGRAVSTARPATGKRLKKTPEKKAGNKDCKADIAFLIDGSFNIGQRRF
NLQKNFVGKVALMLGIGTEGPHVGLVQASEHPKIEFYLKNFTSAKDVLFAIKEVGFRGGN
SNTGKALKHTAQKFFTADAGVRKGIPKVVVVFIDGWPSDDIEEAGIVAREFGVNVFIVSV
AKPIPEELGMVQDVAFVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCAHEQMMCSKT
CYNSVNIAFLIDGSSSVGDSNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRTEFSF
TDYSTKENVLAVIRNIRYMSGGTATGDAISFTVRNVFGPMRDSPNKNFLVIVTDGQSYDD
VRGPAAAAHDAGITIFSVGVAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIRGI
CRDFLESQQ
Download sequence
Identical sequences F6XM71
ENSECAP00000019503 ENSECAP00000019503 XP_001489838.2.31192 9796.ENSECAP00000019503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]