SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000020029 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000020029
Domain Number 1 Region: 241-487
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-85
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 146-246
Classification Level Classification E-value
Superfamily SRCR-like 3.14e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.069
Further Details:      
 
Domain Number 3 Region: 110-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000733
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000020029
Sequence length 490
Comment (Equus caballus)
Sequence
MALNSGSPPGVGPYYENHGYQPESFYSRQPPVAPGAYGAYEAEYYPPTVPRYSPRVLTQA
STPVNHTQPKLLSETVCTLKTKKVLCILLSLGLLLVVLVVAAILLWKFVENKCMGSRIEC
GNSGICTSASQWCDGILHCPNGEDENRCVRLYGLNFILQVYSSQRKSWHPVCEDDWSESY
GRAVCRDMGYGNSFYSSQGIKDDSGATRFMKLNTSADNIDLYKKLYHSDVCSSKKVVSLR
CMECGVSSKQQSRIVGGANAALGEWPWQVSLHVQDVHVCGGSIITPEWIVTAAHCVEPPL
NSPRYWTAFAGILSQSLMFYENGHRVGKVIAHPNYDSKTKNNDIALMKLEAPLTFNDRVK
PVCLPNPGMRLEPKQSCWISGWGATYEKGKTSELLNAAMVPLIEPEQCNNKFIYNDLITP
AMICAGYLEGKVDSCQGDSGGPLVTLKSSIWWLIGDTSWGSGCAKMNRPGVYGNVTVFTD
WIYQEMRVTL
Download sequence
Identical sequences F6ZJM6
9796.ENSECAP00000020029 ENSECAP00000020029 ENSECAP00000020029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]