SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000020200 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000020200
Domain Number 1 Region: 944-1005
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000111
Family PHD domain 0.0035
Further Details:      
 
Domain Number 2 Region: 334-391
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000332
Family PHD domain 0.0024
Further Details:      
 
Domain Number 3 Region: 894-952
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000175
Family PHD domain 0.012
Further Details:      
 
Domain Number 4 Region: 1018-1086
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000354
Family PHD domain 0.018
Further Details:      
 
Domain Number 5 Region: 284-343
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000215
Family PHD domain 0.0095
Further Details:      
 
Domain Number 6 Region: 407-466
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000465
Family PHD domain 0.014
Further Details:      
 
Domain Number 7 Region: 1601-1648
Classification Level Classification E-value
Superfamily HMG-box 0.0000301
Family HMG-box 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000020200
Sequence length 3595
Comment (Equus caballus)
Sequence
RPRSRGKSTVEDEDSMDGLETAETENIVETEIKEQSAEEDAEGEADSSKQPMPALQRSVS
EESASSLVSVGVEAKISEQLCAFCYCGEKSSLGQGDLKQFRVTPGFILPWKSQTSNKKDV
DDNSNGTCEKIQNSAPRKQRGQRKERSPQQNIVSCVSVSTQTASDDQAGKLWDELSLVGL
PDAIDVQALVDPTGTCWAHHRCVEWSLGVCQMEESLLVNVDKAVVSGSTERCAFCKHLGA
TIKCCEEKCTQTYHYPCAAGAGTFQDFSHFFLLCPEHIDQAPERSKEDANCAVCDSPGDL
LDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGY
HTFCLQPVMKSVPTNGWKCKNCRICVECGTRSSSQWHHNCLVCDSCYQQQDNLCPFCGKC
YHPELQKDMLHCNMCKRWVHLECDKPTDPDLDSQFKEEYICMYCKHLAAALDPLQPGEVE
MAVVATDYNNEMEVEGLEDHIVFLEQAVNKDVDGQESTPGIVPDVQIHAGEQQRSNPPEG
LDTHSLLISESSQDKMNPELENKISHEADGEKMEMPSKGLHIGDDQNENKMEVSENVEVL
AHQVDVSPEALQLLAEPKVLASTEESKPPTLLSEPVTVPPETLVSLCAESTSACSKEQLS
FERVQEKVEQTENSESSTACMDFEMTPAVESCVKDSLCQEDKSIKLPSETESSFPSSADI
SKANVSSSPPLSSDLPSHDVLPTYPSALQASVGNIMPTTYISVTPKIGMGKPAITKRKFS
PGRPRSKQGAWSTHNTVSPPSWSPDISEGREIFKPRQLPGSAIWSIKVGRGSGFPGKRRP
RGAGLSGRGGRGRSKLKSGIGAVVLPGVSAADLSSNKDEEENSMHNTVVLFSSSDKFTLH
QDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKA
TDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYT
QCAPCASLSSCPVCYRNYREEDLILQCRQCDRWMHAVCQNLSTEEEVENVADIGFDCSMC
RPYMPTSNVPSSDCCESSLVAQIVTKVKELDPPKTYTQDGVCLTESGMTQLQSLTVTVPR
RKRSKPKLKLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGELMDCDGKSESSPEREA
VDDETKGVEGTEGVKKRKRKPYRPGIGGFMVRQRSRTGQGKTKRSVIRKDSSGSMSEQLP
SRDDGWSEQLPDSLVDESVSVTENTEKIKKRYRKRKNKLEETFPAYLQEAFFGKDLLDTS
RQNRLSLDNVSEDTSQLSYKTNMNTNFLDPSLDPLLSSSSTPAKPGTHGTADDPLADISE
VLNTDDDILGIISDDLAKSVDHSDIGPVADDPSSLPQPSVNQNSRPLSEEQLDGILSPEL
DKMVTDGAILGKLYKIPELGGKDVEDLFTAVLSPATTQPTPLPQPPPPPAPQLLPMHNQD
VFSRMPLMNGLIGPSPHLPHNSLPPGGGLGTFSAIAQPPYSDARDKNPAFNPMASDPNSS
WTSSAPTMEGENDTMSNAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWTTR
VKQIAKLWRKASSQERAPYLAKARDNRAALRINKVQMSNDSMKRQQQQDSIDPSSRIDSD
LFKDPLKQRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQQQQHQQQQQQ
QQFASQPLLAQSGSDTPSSGIQSPLTPQPGNGNMSPAQSFHKDLFTKQLPSTPTSASSDD
VFVKPQAPPPPPTPSRISIQEGLSQSQTSQPPSPQMFSPGSSNSRPPSPVDPYAKMVGTP
RPPPGAHCFSRRNSAALVENCAPLSSVSRPAQMSETTANRPSPVRDLCSSSSTNSDPYAK
PPDTPRPVMTEQFPKPLGLPRSPIVSEQTAKGPLAAGTNDQFTKPPPRADVFQRQRIPDP
YARPLLTPAPVDSGPGPFKTPMQPPPSSQDPYGSVSQAPRRLSVDPYERPALTPRPVDNF
SHNQSSDPYSQPPLTPHAAMNESFAHPSRAFSQPGTLSRPTSQDPYSQPPGTPRPVVDSY
PQPSGTSRSNPDPYSQPPGTPRPTTIDPYSQQPPTPRPSTQTDLFVTSATNQRHSDPYAH
PPGTPRPGISVPYSQPPATPRPRISEGFPRSSMTRPVLMPNQDPFLQAAQSRGAALSGSL
IRPPEVCSQTPRPPGPGLSDTFSRVSPSAAPDPCDQPPLTPRSQSDSFGTSQVAHDVADQ
PRPGSEGNFSAPSNSPMNSQSQQFSSVSQQPGPVPTSGVTDTQNTVNMSQADTEKLRQRQ
KLREIILQQQQQRKLAGRQEKGSQDPAAVPHPGPLQHWQPESISQAFSRPPPPYPGSMRS
PAVPPLGPRYAVFPKDPRGPYPPDVTAMGMRPHGFRFGFPGGSHGTLSCQERFLVPPQQI
QGSGVPPQLRRSLSVDMTRPLNNSQMSNPVGLPQHFSPQSLPVQQHNILGQAFIELRHRA
PDGRPRLPFTASPGNVIEAPSHPRHGNFIARPDFAGPRHTDPMRRPSQGLPNPLPVHPNL
EQVPPSQQEQGHPVHSSSMVMRSLSHPLGGEFSEATLSSSTPAETTSDNLQITTQSSNGL
EEKLDSDDPSVKELDVKDLEGVEVKDLDDEDLENLNLDTEDGKGDELDTLDNLETNDPNL
DDLLKSGEFDIIAYTDPELDLGDKKSMFNEELDLNVPIDDKLDNQCVSTEPKKKEQEDKA
VVASDKHSPWKKSTVTSEIKTEVLSPNSKGETKCESERSDEGKDNVDTPCSQASAHTDVN
DGENPSLQSCDTDLLEKRTNRETAGSNTSAVHGSTQLPAEDVINSCGITGSTPVLSSLLA
NEKPENSDIRPLGSPPPTLPASPSNQVSNLPPPLVTPPGHILDNTMTSNVTAVSRVNHTF
PQGVQVNPGFIQGQSTVNHGFGTGKPTNQTVPLTSQSGTSGLSGPQQLMIPPTLAHQNRE
RPLLLEEQPLLLQDLLDQERQEQQQQRQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMVA
LKGINKVMAQSNMGMPPMVMNRFPFMGQSVTGTQTSEGQNLLPQAMAQDGSITHQISRPN
PPNFGPGFVNDSQRKQYEEWLQDTQQLLQMQQKYLEEQIGAHRKSKKALSAKQRTAKKAG
REFPEEDAEQLKHVTEQQSMVQKQLEQIRKQQKEHAELIEDYRIKQQQQQQQQQCAMAPP
AVMPGVQPQPPLVPGATPSTMSQPSFPMVPQQLQHQQHTAVISGHTSPARMPSLPGWQPP
SAPAHLPLNPPRIQPPLAQLPIKTCTSAPGTVSNANPQSGPPPRVEFDDNNPFSESFQER
ERKERLREQQERQRIQLMQEVDRQRALQQRMEMEQHGMMGSELGSRTPVSQVPFYSSDLP
CDFMQPPRPLQQSPQHQQQIGQVLQQQNMQGSLNSPPTQTFMQTNERRQIGPPPPSFVAD
SPSIPGGSPNFPPVKQVHGGLSGASFQQSPVRPFTPALPAAPPVANSSLPCSQDPVVTHG
QSYPGSTQSLIQLYSDIIPEEKGKKKRTRKKKKDDDTESTKAPSTPHSDITAPPT
Download sequence
Identical sequences F6VDV1
ENSECAP00000020200 9796.ENSECAP00000020200 ENSECAP00000020200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]