SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000020300 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000020300
Domain Number 1 Region: 48-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.48e-39
Family SCAN domain 0.0000508
Further Details:      
 
Domain Number 2 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 385-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 486-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 221-278
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000017
Family KRAB domain (Kruppel-associated box) 0.0096
Further Details:      
 
Domain Number 6 Region: 354-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000441
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000020300
Sequence length 562
Comment (Equus caballus)
Sequence
MTAESREATGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSSLQDTPPPDPEIFRQRFRH
FCYQNTFGPREALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQVWLQEYRP
DSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGMVPLDPVQESSSFDLHPEAAQSHFK
HSSRKPRLLQSRALPATHVPAPHNEGSPRDQAMASALFTADSQAMVKIEDMAVSLILEEW
GCQNLARRNLNRDNRQENYGNVFSQGCENRNENEESTSKAEIAEDSASRGETTGRFQKDF
GEKREQQGRIAERQLRNPEEKTGKEKKDSGPATVKEKKPTTGERGPREKGKGLGRSFSLS
SNFNTPEEVPTGAKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNLV
LHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQR
IHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHTR
ERASEYSPASLDAFGAFLKSCV
Download sequence
Identical sequences F6WEP5
ENSECAP00000020300 NP_001288249.1.31192 XP_008534770.1.77740 ENSECAP00000020300 9796.ENSECAP00000020300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]