SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000020652 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9796.ENSECAP00000020652
Domain Number - Region: 58-83
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0733
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000020652
Sequence length 95
Comment (Equus caballus)
Sequence
PEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEM
EPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT
Download sequence
Identical sequences F6VAU9
ENSECAP00000020652 ENSECAP00000020652 9796.ENSECAP00000020652 9913.ENSBTAP00000035087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]