SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000021220 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000021220
Domain Number 1 Region: 122-365
Classification Level Classification E-value
Superfamily vWA-like 1.7e-84
Family Integrin A (or I) domain 0.000000343
Further Details:      
 
Domain Number 2 Region: 358-452
Classification Level Classification E-value
Superfamily Integrin domains 3.03e-19
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 3 Region: 621-699
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.44e-16
Family Integrin beta tail domain 0.0035
Further Details:      
 
Domain Number 4 Region: 23-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000178
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 535-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000121
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Domain Number 6 Region: 579-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000809
Family Integrin beta EGF-like domains 0.0081
Further Details:      
 
Weak hits

Sequence:  9796.ENSECAP00000021220
Domain Number - Region: 500-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Domain Number - Region: 457-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Integrin beta EGF-like domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000021220
Sequence length 770
Comment (Equus caballus)
Sequence
MLRQRSLLLTLLGLLSLGSALSQECIGYKVSTCRDCIKSGPGCTWCQKLNFTGQGEPDSH
RCDTREQLLQKGCAADDIMDPRSFAETQEDQKRGQKQLSPQKVTIHLRPGQAAAFNVTFQ
RAEGYPIDLYYLMDLSYSMLDDLKNVKKLGGDLLQALNEITKSGRIGFGSFVDKTVLPFV
NTHPEKLRNPCPNKEKECQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNVYKRSNEFD
YPSVGQLAHKLAESNIQPIFAVTERMVKTYEKLTEIIPKSAVGTLSDDSSNVVQLIKAAY
EKLSSRVFLEHGTLPDTLRVTYDSFCSNRVSNVNQPRGDCDNVRIGMPITFQVKVTATEC
VQEQSFVIRALGFSDTVTVQVLPQCECQCRDTSPGRSLCRDKGFMECGICRCDTGYIGKN
CECQTQGRSSQELEGSCRKDNNSLVCSGLGDCVCGQCICHKSDVPNKEIFGQFCECDNVN
CERYDGQVCGGEKRGTCNCGKCQCKEGFEGSACQCPRSTDGCLNQRGTECSGRGRCRCNV
CECDDGYQPPLCQDCPGCPSPCGSYISCAECLKFKKGPYEKTCSVECKNLTLLQEAPSVN
RQCKERDSEGCWMTYTLRQRDGMHSYDIHVEDTRECVEGPNIAAIVGGTVAGVVLIGLLL
LIVWKALTHLSDLREYKRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
Download sequence
Identical sequences F6YNL9
ENSECAP00000021220 9796.ENSECAP00000021220 ENSECAP00000021220 XP_001490052.2.31192 XP_005606240.2.31192 XP_005606241.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]