SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000021870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000021870
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.05e-38
Family SCAN domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 490-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.68e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 591-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 406-447,476-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-17
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 231-292
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000102
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 
Domain Number 6 Region: 546-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000589
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000021870
Sequence length 648
Comment (Equus caballus)
Sequence
MATALEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRCFRYQEAASP
REALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVHGQEVLSEETVHPGVEPESPTELQDPVQTSTPEESHEEMTQ
SPDLEPPEEQSPCHELEFQPLQESEVPLPQDPDLPEERNNGNQEMVALLTALSQGLVTFK
DVAVCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRLDEISHVREEEPLVPDI
PEPQESQEPEILSFTYTGDRSEDEEDYLEQEELSLEDLHRSVLGDPEIHQTPDWEIVFED
DPGRLNERRFGTNISQVNSLTNLRETMPIHPLLGRHHDCPVCGKSFTCNSHLVRHLRTHT
GEKPYKCMECGKSYTRSSHLARHQKVHKMGTPYKFPLNRKNLDETSPRVQAERTPPVEKP
YRCEDCGKHFRWTSDLVRHQRTHTGEKPFFCTICGKSFSQKSVLTTHQRIHLGGKPYLCG
ECGEDFSDHRRYLAHRKTHAAEELYLCSECGRCFNHSAAFAKHLRGHASVRPCRCNECGK
SFSRRDHLVRHQRTHTGEKPFTCPTCGKSFSRGYHLIRHQRTHSEKTS
Download sequence
Identical sequences F6X9S7
ENSECAP00000021870 XP_001917664.1.31192 XP_005611717.1.31192 XP_008516852.1.77740 XP_008516863.1.77740 XP_008516869.1.77740 XP_008516877.1.77740 XP_008516884.1.77740 XP_014596793.1.31192 XP_014699161.1.49734 XP_014699163.1.49734 XP_014699164.1.49734 ENSECAP00000021870 9796.ENSECAP00000021870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]