SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000022990 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000022990
Domain Number 1 Region: 5-93
Classification Level Classification E-value
Superfamily E set domains 3.78e-17
Family Other IPT/TIG domains 0.00000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000022990
Sequence length 924
Comment (Equus caballus)
Sequence
MSRSRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSPSKI
VCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDR
NKGIPPLSLRPSNPLGIEIEKSKFPQKDLEMLFPGMSADFTSENFSASWYLIENHSTTSF
EQLKTAVTNLKRQASKKSEGSLAYVKGGLSTFFEAQDALSAIHQKLEADGTEKVEGSMTQ
KLENVLNRASNTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
VVINDYEKAKSLFGKTEVQVFKKYYAEVETRIEALRQLLLDKLLETPSTLHDQKRYIRYL
SDLHAPGDPAWQCIGAQHRWILQLMHSCREGYVHGLQGTPGLHSPMIDLDNDVRPSVLGH
LSQTASLTRGSSFQSSRDDTWRYKTPHRVAFVEKLTKLVLSQLPNFWKLWISYVNGSLFS
ETAERSGQIERSKNVRHRQNDFKKMIQEVMHCLVKLVRGALLPLSISEGGARQHGGWEGK
SELSGQWLAHVIQTMRLTYESLTALEIPNDMLQTIQDLILDLRVRCVMVTLQHTAEEIKR
LAEKEDWIVDNEGLTSLPCQFEQCIVRSLQSLKGVLECKPGEASVFQQPKTQEEVCQLSI
HIMQIFVHCLEQLSAKPDADVDTAHLSMDVSSPDLFGSIHEDISLTSEQRLLIVLSNCCY
LERHTFLNIAEHFEKHNFQGIEKITQVSMASLKELDQRLFENYIELKADPIVGSLEPGIY
AGYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVLSKVVEAVSEELSRLM
QCVSSFSKNGALQARLEICALRDTVAVHLTSESKSSFKQALEALPQLSSGADKKLLEELL
NKFKSSMHLQLTCFQAAAPPMMKT
Download sequence
Identical sequences F6STY7
ENSECAP00000022990 ENSECAP00000000050 9796.ENSECAP00000022990 XP_001488026.1.31192 XP_005603578.1.31192 XP_014590180.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]