SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000000716 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000000716
Domain Number 1 Region: 227-482
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.83e-62
Family Eukaryotic proteases 0.000000189
Further Details:      
 
Domain Number 2 Region: 51-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-22
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Weak hits

Sequence:  9823.ENSSSCP00000000716
Domain Number - Region: 191-235
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00687
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000000716
Sequence length 486
Comment (Sus scrofa)
Sequence
MPGLRVGELSLGKLHHTGCPGNMWWLLLWGVLQACPTQGSMLLAQPLPLKLTSPGYPEPY
VKDQESFTDIEAPEGFAVKLIFQDFDLEPSPDCEQDSVTITASGMDPSRFCGQQGSPLGS
PPGEKAFVSLGNSLRLTFRASASSEDRPPNLHKGFLALYQAVGVNHSQPISQASGGPEAI
NTPEGNPAKAQSHCKEPYYQPMAAETLTCTTQVPWKQTQEKEVVPGCVPVCGRPVTPIAQ
NREPLGASKAALGSFPWQAFTSIYGRGGGALLGDRWILTAAHTIYPKDGIFLGRRRSAEV
FLGHTDIDEMLRLGGYPVRRVVVHPDYRQDEPHNFHGDIALLELQHRVPLGPSLLPVCLP
DREALYRPGLLGYVSGFGVEMGWLTTELKYSRLPVAPRAACEAWLREKGRTEVFSAGMFC
AGDRMRQQSVCQGDSGGAYVVWDDRARHWVATGIVSWGIGCGEGYGFYTKVLNYVDWIRR
VMDGKD
Download sequence
Identical sequences 9823.ENSSSCP00000000716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]