SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000001273 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000001273
Domain Number 1 Region: 49-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.14e-37
Family SCAN domain 0.000084
Further Details:      
 
Domain Number 2 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.37e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 403-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 319-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 488-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.73e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 217-262
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000235
Family KRAB domain (Kruppel-associated box) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000001273
Sequence length 546
Comment (Sus scrofa)
Sequence
MARESKESAALDAPSAEDRTGILTVKVEKEEASSLAAEAGAPGSPAPGLEHLRQRFRGFR
YPEAEGPREALSRLRELCRLWLRPEMHSKEQILELLVLEQFLTILPGDLQSWVREQHPES
GEEVVVLLEYLERQLDEPVPQVPGDDQGQELLSCKMAVLTPAQKSRNAQFQPMKALLKHE
SLGPQSSPDRALQVPRLALGGRCREDAVVAANLTQESQRPLKMEDVALTLSPGWTQLDSS
QVNSYRDERQENCGSLMALGGEIRTKLRDLPPEEEPPEQEPGQVPCHLGEAIGQIPVCAE
AGEQEGRLQRKQKGAAGTRRHYCHECGKSFAQSSGLTKHRRIHTGEKPYECEDCGKTFIG
SSALVIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSL
LEHHKIHTGEKPYQCNMCGKAFRRNSHLLRHQRIHGDKHVQNPDRGETWESRDRMEHQWQ
NVEAPVSFKCNACERSFTRNRSLIEHQKIHTGEKPYPCDACGKGFTRPSYLVQHQRSHVG
KKILSP
Download sequence
Identical sequences ENSSSCP00000001273 ENSSSCP00000001273 9823.ENSSSCP00000001273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]