SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000004047 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000004047
Domain Number 1 Region: 46-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-39
Family SCAN domain 0.0000434
Further Details:      
 
Domain Number 2 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.18e-28
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 283-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 475-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000004047
Sequence length 534
Comment (Sus scrofa)
Sequence
MAVESRAVSTPVPQNPQEQELILVKVEESLSWGQKFKQNGSTRSCQELFRQQFRKFCYQE
TPGPREALGRLQELCYQWLRPEVHTKEQILELLVLEQFLSILPEELQIWVQQHSPKSGEE
AVTLLEDLEREFDDPGQQVPASPQGPAVPWKDMPCLGPSQDLTDIQLQPLKTQLKPREPC
LSPQSDCKHKESATKKDISKEKSQRPSQEPSFGRVSEHESILEWPQGSAAGQKLRQCPSQ
GTGFSQVIFTHKALGNRDHHEPQRSLILSTNSVTCQKVPSEERPYTCDVCGHSFKQHSSL
TQHQRTHTGEKPYKCNQCGKAFSLRSYLIIHQRIHSGEKAYECSECGKAFNQSSALIRHR
KIHTGEKACKCNECGKAFSQSSYLIIHQRIHTGEKPYECNECGKTFSQSSKLIRHQRIHT
GERPYECNECGKAFRQSSELITHQRIHSGEKPYECNECGKAFSLSSNLIRHQRIHSGEEP
YQCNECGKTFKRSSALVQHQRIHSGDEAYICNECGKAFRHRSVLLRHQRVHTVK
Download sequence
Identical sequences A0A287B716
XP_013854746.1.46622 ENSSSCP00000004047 ENSSSCP00000004047 9823.ENSSSCP00000004047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]