SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000006539 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000006539
Domain Number 1 Region: 61-82,169-246,288-379
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000242
Family FAD/NAD-linked reductases, N-terminal and central domains 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000006539
Sequence length 551
Comment (Sus scrofa)
Sequence
MPVWCCRCSLAGHFRRNYSDTETEGEIFNSLVQYFGDNLGRKVKAMPLVEETSLLEDSSV
TLPVVVIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILHSKLEEARHLSIVDQDLEYLSE
GLEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHLVLGKGPPGGAWHNME
GSRLTISFGNWMELPGLKFKDWVSTKRRNLKGDRVMPEEIARYYKHYVKVMGLQKNFREN
TYITSVSRLYRDQVDNDGQDRDISTPHLQIEKSKFIKRNWEIRGYQRIAEGSHVPFCLFA
ENVALATGTLDSPGRLEIEGEDFPFVFHSMPEFGAAISKGKLRGKVDPVLIVGSGLTAAD
AVLCAYNNNVPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCTQSYSLDSNLLSDY
TSFPEHHVLSFKSDMKCILQNISGLKKIFKLSAAVVLIGSHPNLSFLKEQGCYLGHNSSQ
PITCKGNPVEIDAYTYECVKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKQHL
FVERGGGDGIA
Download sequence
Identical sequences 9823.ENSSSCP00000006539 ENSSSCP00000024348 ENSSSCP00000024348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]