SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000007105 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000007105
Domain Number 1 Region: 805-834
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000428
Family A20-like zinc finger 0.018
Further Details:      
 
Weak hits

Sequence:  9823.ENSSSCP00000007105
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily UBA-like 0.000459
Family TAP-C domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000007105
Sequence length 843
Comment (Sus scrofa)
Sequence
MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVSAALSDFEQLRQVHAGNLPPPFGEGT
GGSRTPDKGLSDRESARPPRPTLQRQDDIVQEKRLSRGISHASSSIVSLARSHVSSNGGG
GGSSEHPLEMPICAFQLPDLTVYNEDFRSFIERDLIEQSMLVALEQAGRLNWWVSVDPTC
QRLLPLATTGDGNCLLHAASLGMWGFHDRDLMLRKALYALMEKGAEKEALKRRWRWQQTQ
QNKESGLVYTEDEWQKEWNELIKLASSEPRMHLGTNGANCGGVESSEEPVYESLEEFHVF
VLAHVLRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPASQCHRSPLVLAYDQAHFS
ALVSMEQKENGKEQAVIPLTDSEHKLLPLHFAVDPGKGWEWGKDDNDNVRLASVILSLEV
KLHLLHGYMNVKWIPVSSDAQAPLAQPESPTASAGDEPRSTPESGESDKESVGSSSASNE
GSKRKEKSKRDRDKDKKRADSVANKLGSFGKTLGSKLKKNMGGLMHSKGSKPGGTGTGSG
GSSGTETLEKKKKNSLKSWKGGKEEAAGDGPVSEKPTSESAGNGGSKYSQEVMHSLSIMR
IAMQGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGVGSG
PPPAKKPEPDGGEELLTAPPAESKAMAFSTGYPGGFTIPRPSVGGVHCQEPRRQLAGGPC
VGGLPPYATFPRQCPPGRPYSHQDNIPSLEPGSHSKDGVHRAALLPPHFRVADSYSNGYR
EPPEPDGWAGGPRGLPSTQTKCKQPNCSFYGHPETNNFCSCCYREELRRREREPGGELLV
HRF
Download sequence
Identical sequences F1SDG3
ENSSSCP00000007105 ENSSSCP00000007105 XP_001925704.4.46622 9823.ENSSSCP00000007105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]