SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000007407 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000007407
Domain Number 1 Region: 13-103
Classification Level Classification E-value
Superfamily DEATH domain 4.66e-21
Family Caspase recruitment domain, CARD 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000007407
Sequence length 233
Comment (Sus scrofa)
Sequence
MEPAAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTS
SRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCS
SCEPFPDGATSNLPRSNSEESNFSDKLRASTVIYHPEGESSTAPFFSTDSSLNLPVLEVG
RTEHPTFSSTTLPRPGDPGAPPLPPELRLEEEGTCGNSSEMFLPLRSRALLRQ
Download sequence
Identical sequences A7XP20
NP_001096683.1.46622 ENSSSCP00000007404 ENSSSCP00000007407 9823.ENSSSCP00000007404 9823.ENSSSCP00000007407 ENSSSCP00000007404 ENSSSCP00000007407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]