SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000008517 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000008517
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily Globin-like 1.01e-49
Family Globins 0.000000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000008517
Sequence length 142
Comment (Sus scrofa)
Sequence
MVLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSHGSDQVKAHG
QKVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNP
SVHASLDKFLANVSTVLTSKYR
Download sequence
Identical sequences F1RGX4
9823.ENSSSCP00000008517 ENSSSCP00000008517 XP_020942625.1.46622 XP_020942626.1.46622 ENSSSCP00000008517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]