SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000011960 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000011960
Domain Number 1 Region: 215-459
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-71
Family Nuclear receptor ligand-binding domain 0.000000000284
Further Details:      
 
Domain Number 2 Region: 105-194
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.28e-28
Family Nuclear receptor 0.0000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000011960
Sequence length 461
Comment (Sus scrofa)
Sequence
LVFFNPPENGLPAWDKPKHCPDGEQDWKLVGMSDACLQRKTYPERRSTLKNEQSSPHLIQ
ATWTSSILHLDHDDVNDQSVPGAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYACKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQRSIGHKPEPTDQEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences ENSSSCP00000011960 ENSSSCP00000011960 9823.ENSSSCP00000011960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]