SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000011996 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000011996
Domain Number 1 Region: 157-291
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.75e-28
Family Toll/Interleukin receptor TIR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 7-123
Classification Level Classification E-value
Superfamily DEATH domain 6.18e-28
Family DEATH domain, DD 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000011996
Sequence length 293
Comment (Sus scrofa)
Sequence
MAEGGSGAESAPPTPSMSSLPLAALNVRVRHRLSLFLNVRTQVAADWTGLAEEMNFEYLE
IRRLETHPDPTRSLLDDWQGRPGASVGRLLELLAKLGRDDVLVELGPSIEEDCRKYILKQ
QQEAAEKPLQVDSVDSSIPWMSGITIRDDPLGQMPEHFDAFICYCPSDIQFVQEMIRQLE
QTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSL
SPGAHQKRLIPVKYKSMKKEFPSILRFITVCDYTNPCTKSWFWTRLARALSLP
Download sequence
Identical sequences A0A0B8RVP7
ENSSSCP00000011996 ENSSSCP00000011996 9823.ENSSSCP00000011996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]