SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000012866 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000012866
Domain Number 1 Region: 694-748
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 778-833
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000632
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number 3 Region: 366-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000726
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 531-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000861
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 454-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000916
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 823-874
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000043
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number 7 Region: 621-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000769
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 8 Region: 739-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000803
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  9823.ENSSSCP00000012866
Domain Number - Region: 48-163
Classification Level Classification E-value
Superfamily SET domain 0.00105
Family Histone lysine methyltransferases 0.052
Further Details:      
 
Domain Number - Region: 424-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00211
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 178-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0175
Family Classic zinc finger, C2H2 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000012866
Sequence length 1135
Comment (Sus scrofa)
Sequence
MAEDGSEEIMFIWCEDCSQYHDSECPELGPVVMVKDSFVLSRARSSLPSNLEIRRLEDGA
EGVFAVTQLVKRTQFGPFESRRVAKWEKESAFPLKVFQKDGHPVCFDTSNEDDCNWMMLV
RPAAEPGHQNLTAFQHGSDVYFTTSRDIPPGTELRVWYAAFYAKRMDKPMLRQACPGLHA
AGTPENSTPVESEPSQWVCKVCSATFPELQLLNEHLLGHLEQTKNVPPASQQESAPEKEA
EAPRGEPPAVPKSVSAAKEQKKKPRRGRKPKASKPEQPLVIVEGKEPAEHVAEIMTEVEP
VTSTTTDERIMELVLGKLATTPTDASSVPKFPHHQGSTITLKRSLILSGRPGIRRKLVRQ
LGEHRRVYQCSLCSKIFQNSSNLSRHVRSHGDKLFKCEECAKLFSRKESLKQHVSYKHSR
NEVDGEYRYRCGTCEKTFRIESALEFHNCRTDDKTFQCEMCFRFFSTNSNLSKHKKKHGD
KKFACEVCNKMFYRKDVMLDHQRRHLEGVRRVKREDAEAGGNLLRYRKEPSGCPVCGKVF
SCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDDHQRAEFIGKIG
ISSEENDDNSDESADSEPHKYSCKRCQLTFGRGKEYLKHIMETHKEKGYGCSICNRRFAL
KATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSHACEQCGK
SFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECRECHRKFAQ
KVNMLKHYKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVTEYML
QKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDAS
SIGIVQPELSLEQEDLAEGKHAKGARRTHKRKQKPEEEAGAAGAEDASFSEFSEKEAPFP
GGVGDETDSAVQSIQQVVVTLGDPNVTAPSSSVGLTNITVTPITTTAGTQFTNLQPVAVG
HLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDLQIHPQPEASNPQSVAHFINLTTLV
NSITPLGSQLGEQHPLTWRAVPQTDVLPPPQPQAPPPQAPQPQGPAEQQPQMYSY
Download sequence
Identical sequences 9823.ENSSSCP00000012866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]