SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000012965 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000012965
Domain Number 1 Region: 33-90,128-252
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.57e-40
Family G proteins 0.00000302
Further Details:      
 
Domain Number 2 Region: 248-362
Classification Level Classification E-value
Superfamily Translation proteins 1.97e-38
Family Elongation factors 0.0000277
Further Details:      
 
Domain Number 3 Region: 364-460
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.1e-31
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000012965
Sequence length 472
Comment (Sus scrofa)
Sequence
MAGGEAGVTLGQPHLSRQDLATLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGT
KGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKESQAKEQYDQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGI
VSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Download sequence
Identical sequences I3LUM9
9823.ENSSSCP00000012965 ENSVPAP00000009935 XP_003135028.3.46622 XP_006193273.1.101512 XP_006213071.1.17985 XP_010968617.1.22495 XP_010995927.1.51371 XP_020936181.1.46622 ENSSSCP00000027829 ENSSSCP00000027829 ENSVPAP00000009935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]