SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000014082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000014082
Domain Number 1 Region: 346-623
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.44e-86
Family Eukaryotic proteases 0.000000000848
Further Details:      
 
Domain Number 2 Region: 104-195
Classification Level Classification E-value
Superfamily Kringle-like 1.45e-32
Family Kringle modules 0.00000845
Further Details:      
 
Domain Number 3 Region: 214-302
Classification Level Classification E-value
Superfamily Kringle-like 6.77e-27
Family Kringle modules 0.00000766
Further Details:      
 
Domain Number 4 Region: 45-103
Classification Level Classification E-value
Superfamily GLA-domain 4.04e-18
Family GLA-domain 0.0000836
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000014082
Sequence length 627
Comment (Sus scrofa)
Sequence
MAHVGGLWLPGCLALAVLVSLVHSQHVFMAPQQALSLLQRARRANSGFFEEMRKGNLERE
CVEEQCSREEAYEALESPSETDAFWAKYTACESVRKSREKLVECLEGNCAEGLGMNYRGN
ISVTRSGIECQLWRSRYPHKPEVNSTMYPGADLRENFCRNPDGSITGPWCYTTSPTVRRE
ACSIPVCAHPPGQGRVTAELIPRSGGSTVNVSPPLETCVPERGRQYQGRLAVTSHGSPCL
AWGSSQAKALSKDQDFNPAVPLVENFCRNPDGDQEGAWCYVAGQPGDFEYCDLDYCEEPV
DEEVGDALGENADAAIEGRTTADDFQPFFNEKTFGAGEADCGLRPLFEKSSLEDKTEKEL
FESYIEGRIVEGSDAEIGLAPWQVMIFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDK
NFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALLKLRKPITFS
DYIHPVCLPDKETATKLLRAGYKGRVTGWGNLKETWTTSASEVQPSVLQVVNLPIVERLV
CKASTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCD
RDGKYGFYTHVFRLKKWMQKVIDRFGG
Download sequence
Identical sequences 9823.ENSSSCP00000014082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]