SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000016068 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000016068
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.24e-38
Family SCAN domain 0.0000505
Further Details:      
 
Domain Number 2 Region: 487-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.51e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 402-444,473-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 588-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-18
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 231-293
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000759
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 
Domain Number 6 Region: 543-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000941
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000016068
Sequence length 644
Comment (Sus scrofa)
Sequence
MATALEPEDQDLWEEEGILMVKLEDDFTCRPESVSQRDDPVLETSHQNFRRFRYQEAASP
REALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVHGQEVLSEETVHPGAEPESPSELQDPAQTLTPEESPEETTQ
SPDLGAPEEQSLCQELEFQPLQESEVSVPQNPALPEERNPANPEVVALLTALSQGLVTFK
DVAVCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRLDEIAHIEEEERSTPDI
PEPQEPDILSFTYTGDRSEDEEEYPEHEDVSVEDLHRSVLGDTEVHQTPDWEIVFEDGPG
RLNGRRCGTNTSQVNSLTSLRETLPLQPMSGRHHDCPVCGKSFTCNSHLVRHLRTHTGEK
PYKCMECGKSYTRSSHLARHQKVHKMSASYKYPLNRKNADEPSPLVQAERIPPIEKPYRC
DDCGKHFRWTSDLVRHQRTHTGEKPFFCTICGKSFSQKSVLTTHQRIHLGGKPYLCGECG
EDFSDHRRYLAHRKTHAAEELYLCSECGRCFSHSAAFAKHLRGHASVRPCRCTECGKSFS
RRDHLVRHQRTHTGEKPFTCPTCGKSFSRGYHLIRHQRTHSEKT
Download sequence
Identical sequences F1S9P8
XP_003357384.1.46622 9823.ENSSSCP00000016068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]