SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000017113 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000017113
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.47e-56
Family D-ribulose-5-phosphate 3-epimerase 0.00000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000017113
Sequence length 190
Comment (Sus scrofa)
Sequence
MDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEAT
ENPGALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMP
KVHWLRTQFPSLDIEVDGGVGPDTIHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCS
EAAQKRSLDR
Download sequence
Identical sequences ENSSSCP00000017111 9823.ENSSSCP00000017113 ENSSSCP00000017111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]