SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000000486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000000486
Domain Number 1 Region: 194-427
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-86
Family SSRP1-like 0.00000495
Further Details:      
 
Domain Number 2 Region: 539-619
Classification Level Classification E-value
Superfamily HMG-box 6.68e-26
Family HMG-box 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000000486
Sequence length 709
Comment (Bos taurus)
Sequence
MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGH
GLKLLTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLS
FDIGDQPVFEIPLSNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEA
FAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVL
RLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVEKRFEG
RLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGFI
YVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNA
KKLNIKNRGLKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENANDSSDDSGEETDE
SFNPGEEEEDVAEEFDSNASASSSSNEGDSDREEKKRKQLKKAKMAKDRKSRKKPLEVKK
GKDPNAPKRPMSAYMLWLNASREKIKSDHPGISVTDLSKKAGEIWKGMSKEKKEEWDRKA
EDARREYEKAMKEYEGGRGESSKRDKSKKKKKVKVKMEKKSTPSRGSSSKSSSRQLSESF
KSKEFVSSDESSSGENKGKKKRRRSEDSEEEELASTPPSSEDSASGSDE
Download sequence
Identical sequences A6QQT5 L8HS69
NP_001094511.1.59421 NP_001094511.1.76553 XP_005908427.1.15283 9913.ENSBTAP00000000486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]