SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000002337 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000002337
Domain Number 1 Region: 174-208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 32-174
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000194
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000002337
Sequence length 273
Comment (Bos taurus)
Sequence
RCQLLQLPQRLLLLGAATLTASALHTADLVDLCGRTRQADGLLLRSHSASRRFYFVAPDM
DCGLWVRAAAPGDRIRLQFRFFLVYSLAPPSMPPPALNASAPLQADPCAPGSYLQLYEGP
PGTPRPLGAPLCGLTIPAPVTTSGDLLGLRLVTRGRQPRVDFVGEVTSFRLGSCGAYFPC
RNGRCIPPSLVCDRWAMDNCGDGSDQASWPPANCGAASPESSQEGNTDDSTSQTLTPSAA
LPSSGPLGTAAEMSPPAHWDPARQGVALEGRWL
Download sequence
Identical sequences F1N2I2
ENSBTAP00000002337 9913.ENSBTAP00000002337 ENSBTAP00000002337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]