SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000003618 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000003618
Domain Number 1 Region: 72-340
Classification Level Classification E-value
Superfamily L domain-like 4e-51
Family Ngr ectodomain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000003618
Sequence length 346
Comment (Bos taurus)
Sequence
MSSQNPERKQSLVGWDSHLSRIFLLLLFVVSAQGLTPNPEACLVFSSVNGSSISCQPPAQ
IPHSLPADTIFLAVEFFNLTQLPADFLQGVPNLQELHLSSNRLEDFSPKFLLPVPQLKVL
DLTRNSLTGLFPGFFRVSAALCTLVLKGNQLKFLEASWLHGLKALRHLDLSENQLHSLPP
GLLENFTDLLTLDLSNNQLQTLPPDLLRGPLNLERLHLEGNRLQVLGEGLLAPQPKLRYL
FLNDNRLASVAAGAFRGLQKLDMLDLSNNLLTTVPTGLWTSLGKAARNLKDGFDISNNPW
ICDQNLADLYRWLVANENKMFFRNHTRCAGPEALKGQTLLAAAESH
Download sequence
Identical sequences Q2KIF2
NP_001039642.1.59421 NP_001039642.1.76553 ENSBTAP00000003618 ENSBTAP00000003618 9913.ENSBTAP00000003618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]