SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000004651 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000004651
Domain Number 1 Region: 47-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-38
Family SCAN domain 0.0000514
Further Details:      
 
Domain Number 2 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.33e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 400-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 316-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 485-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 215-261
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000131
Family KRAB domain (Kruppel-associated box) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000004651
Sequence length 543
Comment (Bos taurus)
Sequence
MARESKESAALDAQSAEDRTGILTVKVEKEDASVLAAEARAPGSPAPSPEHSRQRFRGFR
YPEAEGPREALSRLRELCRLWLRPETHSKEQMLELLVLEQFLTILPTDLQSWMREQHPES
GEEVVALLEYLERQPDGPMPQVLGGGQEQELLCCKMAVLTPIQRPQNIQFQPVKALLKRE
SLGSIPDRVLQVPRLAPGGRCREDAVIATRFAPGSQGPFKMEDVALTVSPGWTQLDSSQV
NLYGDKRQENHGSLTSLGGVVQPKIRELPPDEDHPTQEPGQIPCHLGKATGQIPACAEAG
EQEGRLQRKKTAAGNRRHYCHECGKTFAQSSGLTKHRRIHTGEKPYECEDCGKTFIGSSA
LVIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEH
HKIHTGEKPYQCNMCGKAFRRNSHLLRHQRIHGNKNLQNPDPGRTWESQGRKESQWENVE
VPVSYKCNECERSFTRNRSLIEHQKIHTGEKPFQCDTCGKGFTRTSYLIQHQRSHVGKKI
LSP
Download sequence
Identical sequences E1BHH2
ENSBTAP00000004651 XP_002697494.2.76553 XP_005906215.1.15283 XP_010823681.1.59421 9913.ENSBTAP00000004651 ENSBTAP00000004651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]