SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000004985 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000004985
Domain Number 1 Region: 15-271
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.1e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000004985
Sequence length 755
Comment (Bos taurus)
Sequence
FSFDFKRLRRLSTKYRTEKIYPTATGEKEENVKKNRYKDILPFDHSRVKLTLKTPSQDSD
YINANFIKGVYGPKAYVATQGPLANTVIDFWRMIWEYNVVIIVMACREFEMGRKKCERYW
PLFGEDPITFAPFKISCEAEQARTDYFIRTLLLEFQNESRRLYQFHYVNWPDHDVPSSFD
SILDMISLMRKYQEHEDVPICIHCSAGCGRTGAICAIDYTWNLLKAGKIPEEFNVFNLIQ
EMRTQRHSAVQTKEQYELVHRAIAQLFEKQLQLYEIHGTQKITDGVNEVNTENMISSTDH
DKQDSPPPKPPRTRSCLVEGDAKEEILQPPEPHPVPPILTPSPPSAFPTVTTVWQDNDRY
HPKPVLHMVSSEQPSTDLNRNYSKSMELTGKNESTIDQIDKKLERNLSFEIKKVPLQEGP
RSFDGNTLLNRGHAIKIKSASASPCTVDKISKSQELSSRDLKVDDISQNSCVDCNATQSN
KDPIILPEASQKNSDTPPRPDHLPLDGKGHLTWSFHGPENTLPMPDSSEGKSSDIHCQTM
KTVSSTPSPTIQVETHDLADHHDSSPLFRAPLSFTNPLHSDDSDSDERNSDGSVTKNKTS
ISTASATVSAATSSISTRKVLPMSIARHDIAGTIHSGAEKDVDVSEDSPPPLPERTPESF
VLANEHNTSVRAEWSELQNQEQSEQKNPEGLITSGSETCDHPAQGIHTETCTECPPTVSN
KKDQLSEGPTEATEIGFGNRCGKPKGPRDPPSEWT
Download sequence
Identical sequences F1MWL1
9913.ENSBTAP00000004985 ENSBTAP00000004985 ENSBTAP00000004985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]