SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000006500 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9913.ENSBTAP00000006500
Domain Number - Region: 50-110
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0245
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000006500
Sequence length 211
Comment (Bos taurus)
Sequence
MSAKRVEPKKTSLSKNYRAVCLELKPEPIKTYDYKGAKQEGPFTKPGGTKELKNELREVR
EELKEKMEEIKQIKDVMDKDFDKLQEFVEIMKEMQKDMDEKMDVLINIQKNSKFPLRRGL
KMQQELRLIGKTDTEPQLRLRKMDGAGGAPLSLHKKMVARQQPKDPMDPLHQCDSCFEKC
LLCTPQNNYDRGKLPYHAWASFSPLASGPAF
Download sequence
Identical sequences F1MB56
ENSBTAP00000006500 ENSBTAP00000006500 XP_019831562.1.53367 9913.ENSBTAP00000006500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]