SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000009298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000009298
Domain Number 1 Region: 44-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.7e-35
Family SCAN domain 0.0000449
Further Details:      
 
Domain Number 2 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 514-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 320-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.49e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 214-272
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000248
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000009298
Sequence length 578
Comment (Bos taurus)
Sequence
MAAESRKSLAPSPPDQVPEEDLVIVKVEEDHGWDQESSLHENNPPGQELFRLRFRKLCYQ
ETLGPREALIQLRALCHQWLRPDLNTKEQILELLVLEQFLTILPEELQTLVKEHQLENGE
EVVTLLEDLERQIDILGRPVPARPHGHRVLWEELMHSESAPEPPDTQLQPVAMQHKSAVL
QGPHDRAISVSQSPTPSQKGSPRDQEMTATLLTAGFQTLEKIEDMAVSLIREEWLLDSSQ
KDPSRDNRPENYRNMFSLGGETRNENRELTSKQVISTGIQPHGETAAKCNGDVIGGLEPG
EARDLLGSLERQRGNPTQERRHKCDECGKSFAQSSGLVRHWRIHTGEKPYQCNVCGKAFS
YRSALLSHQDIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCNQCGKAFSQSAG
LILHQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKTFRRSSHLIGH
QRSHTGEKPYKCNECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGNTGLIQHLRIH
TGEKPYQCNECGKAFIQRSSLIRHQRIHSGEKSESTGV
Download sequence
Identical sequences A6QQG2
9913.ENSBTAP00000009298 NP_001093814.1.59421 NP_001093814.1.76553 XP_006051494.1.26621 XP_010816726.1.76553 XP_010816728.1.76553 XP_014337075.1.15283 XP_015315418.1.76553 XP_015315419.1.76553 ENSBTAP00000009298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]