SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000009797 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000009797
Domain Number 1 Region: 11-147
Classification Level Classification E-value
Superfamily Nudix 8.12e-25
Family MutT-like 0.00000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000009797
Sequence length 181
Comment (Bos taurus)
Sequence
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPD
GAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREW
FKVEDAIKVLQCHKPVHAEYLEKLKLGCSPTNGNSTVPSLADSNTLFVTAAQTSGLPSSV
R
Download sequence
Identical sequences A2VDV0
ENSBTAP00000009797 ENSBTAP00000009797 9913.ENSBTAP00000009797 NP_001075087.1.59421 NP_001075087.1.76553 XP_006070281.1.26621 XP_010838003.1.44457 XP_019815907.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]