SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000013640 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000013640
Domain Number 1 Region: 20-146
Classification Level Classification E-value
Superfamily Lysozyme-like 6.44e-47
Family C-type lysozyme 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000013640
Sequence length 148
Comment (Bos taurus)
Sequence
MKAAGILALMGCLVTVVEPKVYTRCKLAKIFSRASLDNYRGFSLGNWICMAYYESHYNTT
AQTQLEDGSTDYGIFQINSDTWCRSTKLQEKNRCHVACSALMTDDLTDAIICAKKIVKET
DGMNYWQGWKKNCEGRDLSEWKKGCEVS
Download sequence
Identical sequences A0JNM6
NP_001071378.1.59421 NP_001071378.1.76553 XP_005889455.1.15283 XP_010858332.1.44457 XP_019828382.1.53367 ENSBTAP00000013640 ENSBTAP00000013640 9913.ENSBTAP00000013640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]