SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000016609 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000016609
Domain Number 1 Region: 318-490,534-707
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.69e-131
Family Mammalian PLC 0.00000000213
Further Details:      
 
Domain Number 2 Region: 943-1196
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 1.7e-57
Family C-terminal domain of PLC-beta 0.00029
Further Details:      
 
Domain Number 3 Region: 148-314
Classification Level Classification E-value
Superfamily EF-hand 1.67e-50
Family EF-hand modules in multidomain proteins 0.00000959
Further Details:      
 
Domain Number 4 Region: 17-146
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-42
Family Pleckstrin-homology domain (PH domain) 0.0000362
Further Details:      
 
Domain Number 5 Region: 728-841
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.09e-22
Family PLC-like (P variant) 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000016609
Sequence length 1234
Comment (Bos taurus)
Sequence
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDSNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNKQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRLGSGVPDS
SVRKRPLEQSNSALSESSATTEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPRKSLGE
EGLQRGPDVLGPAYREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANAVRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQSGPETSQETQTQQL
GCQLNPHPTPSPLDASPRRPPGPATSPTSSSISSSISSPGQRDDLIASILSEVAPAPLDE
LRGHKALVKLRSRQERDFRELYKKHQRKAVALTRRLLDNLAQARAGSRCRQRPGVLSGED
ERAEEEEVSRYQEFQKKQVQCLLELREAQVDTEADRRLEHLQQAQLKLREVVLDAHMTQL
KKLKEINEREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRQERLVAGQQQILQQLAEEEPKLLAQLVQDCQEQRERLPQEIRWSLLGETQEGLG
DGHLVACASNGHAPGSSGHLPGADSESQEETTKL
Download sequence
Identical sequences E1BHX7 L8ILS4
NP_001179352.1.59421 NP_001179352.1.76553 XP_005894184.1.15283 ENSBTAP00000016609 9913.ENSBTAP00000016609 ENSBTAP00000016609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]