SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000016893 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000016893
Domain Number 1 Region: 922-1137
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-37
Family DBL homology domain (DH-domain) 0.0026
Further Details:      
 
Domain Number 2 Region: 1293-1494
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-32
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 
Domain Number 3 Region: 1124-1241
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-21
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000016893
Sequence length 1496
Comment (Bos taurus)
Sequence
FHPLDSPKPPVAPKPKAASSLTPQTPPKFCPSSLRPESLHSPNSSMSRGPKPPIAPKPRL
ATPSEWRASVYVINSLNKCSNGKLPCVDRGLYEEHRSTPECSESEADEDYIVAPRAPPGE
DGARDAGCVENAVTGPPEAGEEEEGQDGGEGCGPAGSAAAEAWAVLSEQADRDVAPAPED
AEGPDCAGAVGTEDQTLASEEEEEKLAEEHRACSLEDEDGEAEPGEPGDGGAEPGDGWAE
SLSDSIPAHLEVLEDTVVGGEEEPGAPGTPQEAEEEDAEPGHSVDEGGEGDDAGEEPPED
EESATGVPEAEVASDDPEVSREACEDAAGYGGQHDGQDEPADPAEAEAGQDPRQGEDPVQ
DEAAEESCHIIPFESDSVDDLVPPLSASPYEFFPTESTSFCSESYPPYSESAGESAQEPG
PEERAERDPEAGPGRERRGSAQGGAGEEGAPVPDVLVLPEDEDANPYEMGVGPTCEADPG
EAETPGAQAALQELSPDAEGGLVPIDRKNVMARARPHSGKLAGYVPETVPEEMGPEAGSA
AAGVGAAAAEGRKTVLSLEGKPLDVGRALPAKPRGFTLYPRSFSVEGREIPVSLYREPEA
CGLEGHGIKRKEDNLSLPCVIGSSGSFSQRSHLPSSGTSTPSSMVDIPPPFDLACITKKP
ITKSSPSLLVESEPPDKHSKKKKSSFKRFLALTFKKKTESKVHVDVNVSSSRSSSESSYH
GPARLLEMDRRSLSNSPQLRARTGKLRACDSPSSLIFCREGKRKGVPFSRTVSRVESFED
RSRPPFLPLPLTKPRSISFPNADTSDYENIPAMNSDYENIQIPPRRPARAGTFTKLFEDQ
SRALSTANENDGYVDMSSFNAFESKPQSADPEAESAYTEPYKVCPISAVAPKEDLTSEEE
RGSSEEEEDRAARDPTLPHKVEGQSRAHVIAQELLSSEKAYVEMLQHLYLDFHGAVVRAL
DEMDYEGKDPVGREELRRGLSELPAIHDLHQGILEELEERLAHWEGQQKVADVFLAREQE
FAHHATHILQFDRYLSLLGENCLHAPRLAAAVREFEQSQQGGGQNVKHRLLRVVRRLFQY
EALLTDYLNNLCPDSAEYDDTQGALTLISKITDRANDSMEQGENLQKLVHIEHSVRGQGD
LLQPGREFLKEGTLMKVTGKNRRPRHLFLMSDVLLYTYPQKDGKYRLKSALAVASMKVSR
PVMEKVPYALKIETPESCLTLSASSCAERDEWHSCVSRALPEDYKAQALAAFQHSVEIRE
RLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRRHHCHACGKIVCRNCSRNKYPLKYLK
DRMAKVCDGCYGELKKRGGDAPGMMRERPLSMSFPLSSARFSSSAFSSVFHSINPSAFRK
QRKVPSALTEVAASGEGSAISGYLNRCKKGKRHWKKLWFVINGKVLYTYAAREDTVALES
MPLLGFTVASSKEEGSSEASPTFHLYHKKTLFYSFKAEDSSLAQRWIEAMEDASVL
Download sequence
Identical sequences F1MUW3
ENSBTAP00000016893 9913.ENSBTAP00000016893 ENSBTAP00000016893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]