SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000017351 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000017351
Domain Number 1 Region: 19-143
Classification Level Classification E-value
Superfamily Lysozyme-like 1.23e-45
Family C-type lysozyme 0.00000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000017351
Sequence length 144
Comment (Bos taurus)
Sequence
VKAVLILGLLLLSVTVQGKVFERCELARTLKKLGLDGYKGVSLSKRLCLTKWESSYNTKA
TNYNPSNESTDYGIYQINSKWWCKTPKAVDGCPVSHSKLMGNDIAKAVACAKKIVSEQGI
TAWVAWKSHCRDHDVSSYVEGCTL
Download sequence
Identical sequences F1MC59
ENSBTAP00000017351 ENSBTAP00000017351 9913.ENSBTAP00000017351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]