SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000018650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000018650
Domain Number 1 Region: 871-1081
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-55
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 1244-1430
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-26
Family Pleckstrin-homology domain (PH domain) 0.00000889
Further Details:      
 
Domain Number 3 Region: 1070-1190
Classification Level Classification E-value
Superfamily PH domain-like 7.8e-25
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000018650
Sequence length 1434
Comment (Bos taurus)
Sequence
YFPFLEIKKPPVAPKPKFVLAANKPAPPPVAPKPEILVSSVPQSTKKTKPSIAPKPKVLK
ASPVQDITQSPSRKIVVNLEEHTQEFPESIDNSNCRNRGHPSSDYILPVCSCHPGCNHKL
ESRKNLYVKQLVLGPLEMHENLENNKIGESPSAVKNQHKCDSVGERVKSQSKVVLKASIL
EEKLKDVLTQPMSPFLFPQKHRSTDSPEMSDGCNSHRQFSIEFADLSPSLSSFENVSNHH
PCHLQLPSTEFQNFETNQNDSEKSNTCYHSSEQEALENGKRSPFLSSDGDSKKSEARDLG
PLEIHLVPCTPKFPTPKPRKTHVARLLRQRHIDTSSESTEEPEDVDSLPHVFEDSLKNNK
ISVFHQTALCNQEQVDKVKPENKGELNVDLTGDRQNSVYSQKALRPETFSSEKTAPPLET
DSNLSSDDKSGDSSGMSLAEDKGISFIRCSTLSMSLPKQLKLTCSEHLPTASNPGVSAPQ
MQKESMIKGESSSKVVPKKPQRHSLPAAGVLKKAASEELLEKSSYPSNEEKDAEKGLERD
HVQHLCAPNNGMSSSFDMPKRASEKPVWKLPHPIIPFSGNPESLKSVTISSNSETPTPLT
KPRAKSLSAMDVERCTKPCKDSHKKNSLKKLLNMKLSICFMKSDFQKFWSKHSHLGDTTS
GSLAGGEQRGSESDWHGLLVGEEKRSKPIKAYSADNYSLESHKKRKKLRGHTNAANGPRA
ESLDDQMLSRESSLQAPCKSVTSDCVPEYENIRHYEEIPEYENLPFVMAMGKTPELERRN
SSSVEDTDANVYEVQEPYEAPDGQLQLGPRHQHSSSSGASQEGQSDLDLGLGDLPSDEEE
VINSSDEDDVSSASSKGEPDLLDDKQGEDTGMKCKVHHIAKEIMSSEKVFVDVLKLLHID
FRDAVAHASRQLGKPVIEDRILNQILYYLPQLYELNRDLLKELEERMSNWTEQQRIADIF
VKKGPYLKMYSTYIKEFDKNIALLDEQCKKNPGFAAVVREFEMSPRCANLALKHYLLKPV
QRIPQYRLLLTDYLKNLLEDSGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYS
LNGHHEIVQPGRVFLKEGILMKLSRKVMQPRMFFLFNDALLYTTPVQSGMYKLNNMLSLA
GMKVRKPTQEAYQNELKIESVERSFILSASSAPERDEWLEAISRSIEEYAKKRITFCPSR
SLDEADSEDKDEVSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACS
SNKYGLDYLKNQPARVCEHCFQELQKLDHQHSPKFGSPGNHKSPSSALSSVLHSIPSGRK
QKKIPAALKEVSANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASEDVAALES
QPLLGFTVTQVKDENSESRVFQLLHKNMLFYVFKADDAHSAQKWIEAFQEGTIL
Download sequence
Identical sequences F1MQ30
ENSBTAP00000018650 9913.ENSBTAP00000018650 ENSBTAP00000018650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]