SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000020709 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000020709
Domain Number 1 Region: 118-176
Classification Level Classification E-value
Superfamily RING/U-box 1.05e-17
Family ZZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 393-442
Classification Level Classification E-value
Superfamily UBA-like 2.45e-17
Family UBA domain 0.00012
Further Details:      
 
Domain Number 3 Region: 42-100
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000306
Family PB1 domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000020709
Sequence length 446
Comment (Bos taurus)
Sequence
MASLTVKAYLLGKEDAAREIRRFSFCFSPEPEAEAEAAPGPRPCERLLNRVAALFPVLRP
GGFQAHYRDNLDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDQRPSCAQEV
PRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSACEGKGLHREHGKLAFPSPIGHFSE
GFSHSRWLRKLKHGHFGWPAWEMGTPGNWSPRPPQAGDAHPGPATESETKASGPSEDPSV
NFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPTSAGSSSTEEKCSSQPSSCCSDPS
KPDRDVEGTAQSLTEQMNKIALESGGQHEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQ
SLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLT
RLLQTKNYDIGAALDTIQYSKHPPPL
Download sequence
Identical sequences 9913.ENSBTAP00000020709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]