SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000021497 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000021497
Domain Number 1 Region: 146-292,331-346,428-470
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.36e-49
Family Hemopexin-like domain 0.00054
Further Details:      
 
Domain Number 2 Region: 21-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000183
Family Somatomedin B domain 0.0000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000021497
Sequence length 476
Comment (Bos taurus)
Sequence
MTSLRPLLMLALLAWVVVADQESCKGRCTEGFNATRKCQCDELCSYYQSCCADFMAECKP
QVTRGDVFHLPEDEYGFHDYSDAQTVNSNVEAQPESTTLAPVLQAQTLETPVQAPVLNPE
KEVPPSGRGDSEPGMGTSDLGTSESPAEEETCSGKPFDAFTDLKNGSLFAFRGLYCYELD
EKAVRPGYPKLIRDVWGIEGPIDAAFTRVNCQGKTYLFKGSQYWRFQDGVLEPDFPRNIS
DGFGGIPDDVDAALALPAHNFNGRERVYFFKGNHYWEYVFQQQPSQEDCEGSSLPAAFKH
FALMQRDSWVDIFRLLFWGGSYGGAGQPQLISRNWFGLPGRLDAAMAGHIYVSGSAPSFP
RAKMTKSARRHRKRYRSLRSRGRGRGRNQNPYRRSRSAFLSWLSSEELGLGANNYDSFEM
DWLVPATCEPIQSVYFFSEDKYYRVNLRTRRVDAVIPPYPRSIAQYWLGCPVPGQA
Download sequence
Identical sequences Q3ZBS7
ENSBTAP00000021497 9913.ENSBTAP00000021497 NP_001030222.1.59421 NP_001030222.1.76553 ENSBTAP00000021497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]