SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000022924 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000022924
Domain Number 1 Region: 101-148
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000693
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 62-103
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000106
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000022924
Sequence length 291
Comment (Bos taurus)
Sequence
RAGPGCSGAGALRGTPALAPKVCRARAMRTLWMALCVLARLWPGALAGCADAGRCCPGRD
PACFASGWRQDRVYGTCFCDQACRLTGDCCFDYARACPARPCIVGEWSPWSGCASQCRPT
ARVRRRAVQQEPQNGGEPCPALEERAGCLEYATPQGEDCGHAFVPAFITTSAFNKERTRQ
AASPHWTTSTEDAGYCMEFKTESLTHHCALENRPLTRWMQYLREGYTVCVDCQPPAMNSV
SLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVEQCSCPAVHSFIFI
Download sequence
Identical sequences 9913.ENSBTAP00000022924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]