SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000023221 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000023221
Domain Number 1 Region: 230-322
Classification Level Classification E-value
Superfamily EF-hand 1.66e-18
Family EF-hand modules in multidomain proteins 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000023221
Sequence length 415
Comment (Bos taurus)
Sequence
MKWRTILPQCCLLLVTCALPALESVPIDIDKTKVKTTQPVDSAKIEPPDTGLYYDEYLKQ
VIDVLETDSHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVARLRMLIKA
KLDSFQDTGMDHHALLKQFDHLNHLNPDKFESTDLDMLIKAATSDLEHYDKARHEEFKKY
EMMKEHERREYLKTLSEEKRKEEESKFAEMKKKHENHPKVNHPGSKDQLKEVWEEADGLD
PNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREH
VMNEVDTNKDRLVTLDEFLKATEKKEFLEPDSWETLDHQQFFTEEELKEYENLISVQESK
LKKKADELQKQKEDLQRQHDQLEAQKLEYHQVVQQMEQKKLQQISPSAPGGESKI
Download sequence
Identical sequences Q0IIH5
ENSBTAP00000023221 9913.ENSBTAP00000023221 ENSBTAP00000023221 NP_001068849.1.59421 NP_001068849.1.76553 XP_005215987.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]