SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000023305 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000023305
Domain Number 1 Region: 217-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.65e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 180-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000446
Family Classic zinc finger, C2H2 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000023305
Sequence length 291
Comment (Bos taurus)
Sequence
MPRSFLVKTHSSHRVPNYGQLETQRDTSGACAACGGLVVPFVLPDKAAPSTSGDPPQPWD
FTSVVAHVSLPLPTFLGNEEAGRALGPGPLEVSLEDPRAGRAPSAPLRDSVNHLNLPPLL
ALPTRWPSILNADGAQAPGCCLPGAERAPCSPGGFPCHRPFHAPAALAGHQQLHCHLQAQ
RCFTCKFCDKEYGSLGALKMHIRTHTLPCLCAICGKAFSRPWLLQGHLRTHTGEKPYTCP
HCSRAFADRSNLRAHLQTHSDTKKYRCKRCAKTFSRMALLARHEEAGCCAP
Download sequence
Identical sequences E1BH01
ENSBTAP00000023305 ENSBTAP00000023305 NP_001179562.1.59421 NP_001179562.1.76553 XP_005218680.1.76553 9913.ENSBTAP00000023305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]