SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000024059 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000024059
Domain Number 1 Region: 68-201,237-339
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.88e-58
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000516
Further Details:      
 
Domain Number 2 Region: 348-445
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.83e-27
Family Anticodon-binding domain of PheRS 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000024059
Sequence length 446
Comment (Bos taurus)
Sequence
MVCWALRRVGLARAHLARKASGVCRGHEHQPLGPRPAAPGAPGSAVELLGKSYPQDDYSN
LTRKVLSKVGRNLHNQPQHPLWLLKERVKQHFYAQYPGRAGTPLFSVYDDLSPVVTTWQN
FDSLLIPADHPSRKKGDNYFLNATHMLRAHTSAHQWDLLRAGLDAFLVVGDVYRRDQIDA
QHYPVFHQLEAVRLFSRHQLFAGIKDGENLQLFEQSSRSAHKQETHTLEATKLVEFDLKQ
TLTRLMTHIFGDGLDVRWVDCYFPFTHPSFEMEINFHGEWLEVLGCGVMEQQLVNSAGAQ
DRIGWAFGLGLERLAMILYDIPDIRLFWSQDERFLKQFRVPDINQKVTFQPLSKYPAVIN
DISFWLPRENYTENDFYDLVRTIGGDLVEKVDLIDKFEHPKTHRTSHCYRITYRHMERTL
SQREVGGIHQAVQEAAVRQLGVEGRF
Download sequence
Identical sequences Q08D87
9913.ENSBTAP00000024059 ENSBTAP00000024059 ENSBTAP00000024059 NP_001070273.1.59421 NP_001070273.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]