SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000026407 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000026407
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily EF-hand 1.05e-49
Family p25-alpha 0.000000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000026407
Sequence length 176
Comment (Bos taurus)
Sequence
MAASTDVAGLEESFRKFAIHGDPKASGHEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFS
KVKAKSARVINYEEFKKALEELAPKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGG
AVERLTDTSKYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
Download sequence
Identical sequences A0A212DCW4 L8IH45 Q3ZCC8
9913.ENSBTAP00000026407 ENSBTAP00000026407 ENSBTAP00000026407 NP_001029946.1.59421 NP_001029946.1.76553 XP_005218783.1.76553 XP_005896612.1.15283 XP_005896613.1.15283 XP_006072101.1.26621 XP_006072102.1.26621 XP_010849344.1.44457 XP_010849345.1.44457 XP_019835234.1.53367 XP_019835235.1.53367 XP_019835236.1.53367 XP_020740567.1.74333 XP_020740568.1.74333 XP_020740569.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]