SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000026785 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000026785
Domain Number 1 Region: 637-705
Classification Level Classification E-value
Superfamily EF-hand 0.00000692
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000026785
Sequence length 732
Comment (Bos taurus)
Sequence
MASILLRSCRGRGPARLPPPRSAAPRGPAGDLACLSGASAVGLMSYVPLPLGSCAPVHPV
YLSLRADPLGCWTLRPKRACAVLAGPRLLPVRCWHSSRPLGDDSVVEKSLRSLKDKNKKL
EEGGPVYSPPAQAAVRKPLGQRVLDELRHYYHGFRLLWIDTKIAARMLWRILHGHSLTRR
ERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVAVKLFPNMLPSTFETQSSKEERLKKEL
RVKLELAKFLQDTIEEMALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFED
ELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKLIAEEGVDSLNVKE
LQAACRARGMRALGVTEDRLRGQLKQWLELHLHQEIPTSLLILSRAMYLPETLSPADQLK
STLQTLPEIVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEHREKELQRKSQAAVA
QAAKEVEPEVVAEGAPGRPVAELQPEEPAVTLPSEVLKDSAPVLEGLKEEEITQEEIDVL
SNACSKLKEQKKSLTKEKEELELLKGDVQDYSQDLQEIKKELSKTGEEMYVEESKASKRL
TKRVQQMIGQMDSLLAQLEADQKAGRLGPAAEAAPAGETVISVSELINAMKQIKHIPESK
LLSLASALDDNKDGKVDIDDLVKVIELVDKEDVHISTSQVAEIVATLEKEEKVEEKEKAK
EKAEKEAAEVQN
Download sequence
Identical sequences F1N3R4
ENSBTAP00000026785 ENSBTAP00000026785 9913.ENSBTAP00000026785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]