SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000026996 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000026996
Domain Number 1 Region: 243-531
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000026996
Sequence length 539
Comment (Bos taurus)
Sequence
MCCSERLPGVPQPVGMEALDQAEGPAASQREMPPPPPASPPSEPAQKPPPRGAGSHSLTA
RSSLCLLAASQFLLACGMLWLSGFGPIWTQNTTDVVSSALTFLEQLGPSAWLGTGTWDAP
SLLLVSLCVILITTLVWLLLRTPPEPTSPLPPEDRRQSVSRQPSFTYSEWMEEKVEDDFL
DLDPVPETPVFDCVMDIKLEADPTSLTVKAMGLQERRGSNVSLTLDMCTPGCNEEGFGYL
MSPREESAREYLLSASRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKN
RYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVGDFWRM
VWQEHTPIIVMITNIEEMNEKCTEYWPEEQVVYDGVEITVRKVIHTEDYRLRLIALRSGT
EERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIVVHCSAGIGRTGCF
IATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLSRQSPE
Download sequence
Identical sequences A6QQD4
ENSBTAP00000026996 ENSBTAP00000026996 9913.ENSBTAP00000026996 NP_001095763.1.59421 NP_001095763.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]