SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000027207 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000027207
Domain Number 1 Region: 17-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.57e-77
Family Eukaryotic proteases 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000027207
Sequence length 256
Comment (Bos taurus)
Sequence
RMTTAGNSWGWFLGHLLLSVTGSLAWGGSSRIINGEDCRPHSQPWQAALFLENEFFCGGV
LVHPQWVLSAAHCFQKSYTIGLGLHSLEADQEPGSQMIEAHLSIQHPEYNKPSLANDLML
IKLEESVPPSDTIQDISIASQCPAAGGDSCLVSGWGRLVNGKLPKVLQCVNISVVSEKIC
SELYAHVYHPSMFCAGGGQDQKDSCHGDSGGPLVCNGSLQGLVSFGQAQCGQPYVPSVYT
NLCKFTDWIQKTIQAS
Download sequence
Identical sequences F1MLB5
ENSBTAP00000027207 ENSBTAP00000027207 9913.ENSBTAP00000027207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]