SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000028324 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000028324
Domain Number 1 Region: 695-749
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 779-834
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000669
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number 3 Region: 365-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000371
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 532-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000868
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 453-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000103
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 740-781
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000918
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 7 Region: 824-875
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000286
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number 8 Region: 622-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000293
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Weak hits

Sequence:  9913.ENSBTAP00000028324
Domain Number - Region: 48-163
Classification Level Classification E-value
Superfamily SET domain 0.00105
Family Histone lysine methyltransferases 0.052
Further Details:      
 
Domain Number - Region: 424-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00619
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number - Region: 180-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0131
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000028324
Sequence length 1135
Comment (Bos taurus)
Sequence
MAEDGNEEIMFIWCEDCSQYHDSECPELGPVVMVKDSFVLSRARSSLPSNLEIRRLEDGA
EGVFAVTQLVKRTQFGPFESRRVAKWEKESAFPLKVFQKDGHPVCFDTSNEDDCNWMMLV
RPAAEPGHQNLTAFQHGSDVYFTTSRDIPPGTELRVWYAAFYAKRMDKPMLRQACPGLQA
AGTPENSTPVEAEPSQWVCKVCSATFLELQLLNEHLLGHLEQSKSGAPAGQQESAPEKEA
DVPRGEPAEVPKTVSATKEQKKKPRRGRKPKASKPEQPLVIVEGKEPAEQVTEIMTEVEP
VTVTPDERIMELVLGKLAATPSDTSSVPKFPHHQSGTITLKRSLILSSRHGIRRKVVRQL
GEHRRVYQCSICSKVFQNSSNLSRHVRSHGDKLFKCEECAKLFSRKESLKQHVSYKHSRN
EVDSEYRYRCGTCEKTFRIQSALEFHNCRTDDKTFQCEMCFRFFSTNSNLSKHKKKHGDK
KFACEVCNKMFYRKDVMLDHQRRHLEGVRRVKREDVEAGGGENLVRYRKEPSGCPVCGKV
FSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDDHQREEFIGKI
GISSEENDDHSDESADSEPHKYSCKRCQLTFGRGKEYLKHIMEVHKEKGYGCSICHRRFA
LKATYHAHMVIHRENLPDPKRAEYIHPCEICGRIFNSIGNLERHKLIHTGVKSHACEQCG
KSFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECRECHRKFA
QKVNMLKHYKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVTEYM
LQKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDA
SSIGIVQPELSLEQEELAEGKHVKATRRAPKRKQKPEEEAGATGPEDAAFSEFSEKEGSF
SGGVGDETDSAVQSIQQVVVTLGDPNVTTPSSSVGLTNITVTPITTTAGTQFTNLQPVAV
GHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDLQIHPQPEASNPQSVAHFINLTTL
VNSITPLGSQLGEQHPLTWRAVPQTDGPPPPPPAPAQQAAQPSVPAEQQPQMYSY
Download sequence
Identical sequences 9913.ENSBTAP00000028324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]