SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000028494 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000028494
Domain Number 1 Region: 211-482
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.06e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000224
Further Details:      
 
Domain Number 2 Region: 9-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000809
Family MarR-like transcriptional regulators 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000028494
Sequence length 508
Comment (Bos taurus)
Sequence
MADGPVAEVLLRRLEAADGGLDSAELATELGVEHQTVVGAVKSLQALGQIIETELRSTKR
WELTAEGEEIAQEGSHEARVFRSIPPEGLPQSELMRLPSGKVGFSKAMSNKWIRVDKSAA
DGPRVFRVVDSVEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLTEATLKTYWVSKGSA
FSTSISKQETELSPEMISSGSWRDRPFKPYNFSAHGVLPDSGHLHPLLKVRSQFRQIFLE
MGFTEMPTDNYIESSFWNFDALFQPQQHPARDQHDTFFLRDPAQAQQLPMDYVHRVKRTH
SQGGYGSQGYKYTWKLDEARKNLLRTHTTAASARALYRLAQKKPFTPAKYFSIDRVFRNE
TLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEIF
SYHQGLKKWVEVGNSGIFRPEMLLPMGLPENVSVIAWGLSLERPTMIKYGINNIRELVGH
KVNLQMVYDSPLCRLDAERGPPSTQEAA
Download sequence
Identical sequences A7MBD4
ENSBTAP00000028494 9913.ENSBTAP00000028494 NP_001094577.1.59421 NP_001094577.1.76553 XP_019819602.1.53367 ENSBTAP00000028494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]